PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024973096.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 505aa    MW: 57783.2 Da    PI: 6.0373
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024973096.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-093764131954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   n+yp+ +e+  LA+++gLt +q+ +WF N R +
  XP_024973096.1 376 FEHflNPYPKDSEKMMLARQTGLTRSQIANWFINARVR 413
                     664459******************************88 PP

2BELL99.82.1e-32242313172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+q+lq+k++kL+sll+eVd++Y+ y++ql++v ++ ++vag+g+a++Yt+lA ++iSrhFrcL+dai +q+
  XP_024973096.1 242 EKQDLQNKITKLVSLLDEVDRKYREYCQQLRVVEAALDMVAGCGAARSYTTLAHQTISRHFRCLRDAINGQV 313
                     6899*****************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    
MATYYPSSTN HQFPNSYLST QQQQIDSYQE SPIPPIDMMY QNQNSTDSSF LELLSTNPQN  60
PSRIENHHSL DDQERNLQYQ ELSLSLGMQI TSSSMDLPSF QYNYLNPHLQ DSGDHGSQSN  120
KVENIDYLSF DLVGGVSGVV KDRSTNHGQC SISGYQIPTG VVARIYNSRY LKPSQELLEE  180
VANLHEAIRQ IKMNKRNNLH KLGVDRFDEK NSRIDSQSVR SSINGEPLES ITSSSGQLSA  240
SEKQDLQNKI TKLVSLLDEV DRKYREYCQQ LRVVEAALDM VAGCGAARSY TTLAHQTISR  300
HFRCLRDAIN GQVQATRQSL GDQDDSSDRV LPRLRNVEKQ LRQQGSLHPL GVMRHSWRPQ  360
RGLPEGSVSL LRAWLFEHFL NPYPKDSEKM MLARQTGLTR SQIANWFINA RVRLWKPMVE  420
DMYKEEFRDQ EVNGRSSPKA AIDQSWSSED KEKDLQPKTS SRINDSNPEF VNDMEVNGYV  480
AQRHIDLADQ YRFDDPQLLP DFVVE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-100TALE family protein