PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024963953.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 434aa    MW: 48103 Da    PI: 6.3257
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024963953.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073714042154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_024963953.1 371 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 404
                     569*****************************87 PP

2ELK28.82.8e-10325346122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_024963953.1 325 ELKHELKQGYKEKIVDIREEIL 346
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    
MAYHPNHISQ DMALQQHFSD TDNNSVLRTI LPEHHHLASA AQSPSSSRSA GKDHWLNSAI  60
LRQQGQFGGD GNNNNSNIFL NLQTNNNNSD SAATTSSQHH QQQSAVNVMS SHNSPDLNNH  120
SRNVAAGQVD NNVGGELGET EVGAGDGGGG ALMNWQNARQ KAEVLSHPLY EQLLAAHVAC  180
LRIATPVDQL PRIDAQLAQS QQVVSKYSAL GGHNNLVHDD KELDQFMTHY VLLLCSFKDQ  240
LQQHVRVHAM EAVMACWEIE QSLQSLTGVS PGEGTGATMS DDDEDQVDSD ANLYDGSLDG  300
HDSMGFGPLV PTESERSLME RVRQELKHEL KQGYKEKIVD IREEILRKRR AGKLPGDTTS  360
VLKAWWQSHA KWPYPTEEDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP SSSTVLKSKR  420
KSSNAGDRDG DHVM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-174TALE family protein