PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024963952.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 458aa    MW: 50814 Da    PI: 6.4338
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024963952.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-074074402154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_024963952.1 407 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 440
                     569*****************************87 PP

2ELK28.73e-10361382122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_024963952.1 361 ELKHELKQGYKEKIVDIREEIL 382
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    
MAYHPNHISQ DMALQQHFSD TDNNSVLRTI LPEHHHLASA AQSPSSSRSA GKDHWLNSAI  60
LRQQGQFGGD GNNNNSNIFL NLQTNNNNSD SAATTSSQHH QQQSGNNQWL SRSILQRNVS  120
DVRGDDGIPQ VSNDSIMAAT AVNVMSSHNS PDLNNHSRNV AAGQVDNNVG GELGETEVGA  180
GDGGGGALMN WQNARQKAEV LSHPLYEQLL AAHVACLRIA TPVDQLPRID AQLAQSQQVV  240
SKYSALGGHN NLVHDDKELD QFMTHYVLLL CSFKDQLQQH VRVHAMEAVM ACWEIEQSLQ  300
SLTGVSPGEG TGATMSDDDE DQVDSDANLY DGSLDGHDSM GFGPLVPTES ERSLMERVRQ  360
ELKHELKQGY KEKIVDIREE ILRKRRAGKL PGDTTSVLKA WWQSHAKWPY PTEEDKARLV  420
QETGLQLKQI NNWFINQRKR NWHSNPSSST VLKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1438458RKRNWHSNPSSSTVLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-173TALE family protein