PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024961292.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 420aa    MW: 47396.3 Da    PI: 6.2514
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024961292.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.8e-073673992254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_024961292.1 367 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 399
                     59*****************************87 PP

2ELK28.82.7e-10320341122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_024961292.1 320 ELKHELKQGYKEKIVDIREEIL 341
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    
MAFHDNISHE MALQHYADQH QLTESVEVLR GILPSDHHHH IAHSSSSPDA GPKTSQSPPP  60
TWLNSAILRQ QNHHYAGDGS GGSFLHLQTT NSDSSNSNNH WLSPRPIDND DSNRESMFVS  120
AINSDNNIDD NAMKVSQRQS ESDGNGGNHE RDWEFAKCKA DILSHPMYDQ LLSAHVSCLR  180
IATPVDQLPR IDAQLAQSQQ VISKYSVFGN HNQPLDDKDL NQFMAHYVVL LSSFKEQLQQ  240
HVRVHAMEAV MACWELEQSL QSLTGVAPGE GTGATMSDDD EEQVDSDTNL FDGGLDVSDS  300
MGFGLPTESE RSLMERVRQE LKHELKQGYK EKIVDIREEI LRKRRAGKLP GDTTSLLKAW  360
WQSHSKWPYP TEEDKARLVQ ETGLQLKQIN NWFINQRKRN WHSNPSSSTA VKSKRKSNAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-169TALE family protein