PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024959891.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 604aa    MW: 66602.6 Da    PI: 6.4242
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024959891.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093724091954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_024959891.1 372 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 409
                     664559******************************88 PP

2BELL1252.9e-40234305172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+q+ q+k +kL+s+l+eVd+rYkqy++q+q+v+s+F+++ag+g+akpYt+lAl++iSrhFrcL+dai +qi
  XP_024959891.1 234 EKQDFQNKMTKLISMLDEVDRRYKQYYHQMQIVVSAFDVIAGCGTAKPYTALALQTISRHFRCLRDAINGQI 305
                     67999*****************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    
MSSYIPNSEN GRHSAPMLYL REPLQDSYSS ESPILAGNVM MYMNFSSASA GEFSGSLTRN  60
SQQPHNTCID IPNVGVHDSS VVSHQEFLSS MGEPWRDGRN HEMVLMDQMG SRNLQGQGQG  120
KGLSLSLGSH PGIQFHSSDY QNPNLGFSSF LSPDSVVENS SKDVSPYGIG NVSRAISDSK  180
YLKAAQQLLD EIVNVGKALK QHNSRKESTD DSKGVDGESK NVNQQESNEF SAAEKQDFQN  240
KMTKLISMLD EVDRRYKQYY HQMQIVVSAF DVIAGCGTAK PYTALALQTI SRHFRCLRDA  300
INGQIKEAQR SLGETDSTTN GKGVGISRLR FVDQQLKQQR ALQQIGMMQQ HTWRPQRGLP  360
ENSVSILRAW LFEHFLHPYP KDSDKIMLAR QTGLTRSQVS NWFINARVRL WKPMVEEMYK  420
EEAGDAEMES NSSSEMAPKD TEGNRKTSAD QGEDKNQSTA ASSAFDSKSF NQAHNTEMVG  480
TSTDSDFQNM MLQSNRGERE RLVAAYQMQR RFGNRNGGGV SLTLGLQNCE DGSLPPMASI  540
GSHNHSFVDV RGGGGGGGGS GGRGVYDTAT GSSVEAETID FDCVDSSNRQ QRFGSSHLLH  600
DFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-128TALE family protein