PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027367691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 667aa    MW: 72549.9 Da    PI: 7.2471
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027367691.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-093714081954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_027367691.1 371 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 408
                     554459******************************88 PP

2BELL124.44.6e-40235306172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+s+l+eV++rY+qy++q+q+vissFe++ag+gsa+ Yt+lAl++iS++FrcLkdai++qi
  XP_027367691.1 235 ERQEIQMKKAKLISMLDEVEQRYRQYHNQMQIVISSFEQAAGIGSARTYTALALQTISKQFRCLKDAITGQI 306
                     79*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    
MATYFHSNSE IQGGADGLQT LVLMNPGYVQ YSDTSTPSHG GNLVFLNSAG GGGGNSSLSP  60
QNLPHAPPPH TQQFVGVPLS AAAASLQEPP SMHHEVSALH GFLPRMQYNL WNAIDPNAAA  120
REASRATQGL SLSLQAQAGD DMRVSGGSSS SASGVTNGGG VSGIQSVLLS SKYLKATQEL  180
LDEVVNVNGG IKVEQAKKSF DKTKVVGESS TAASGDGSVV AEGSGKRSSE LSTTERQEIQ  240
MKKAKLISML DEVEQRYRQY HNQMQIVISS FEQAAGIGSA RTYTALALQT ISKQFRCLKD  300
AITGQIRAAN KSLGEEDCFG GKIEGSRLKY VDHHLRQQRA IQQLGMIHHN AWRPQRGLPE  360
RSVSVLRAWL FEHFLHPYPK DSDKHMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYME  420
EMKEHEVNGS EDKSSKSSED PAMKTTPQER GPTSEIESKS FNSKQDVSKN QNTPIISASP  480
PSTSPVGGNV RNQSAFSFIG SSELDGITQG SPKKPRNHEI LHSPNRVPSI NMDVKVNEAN  540
NEQLSMDGRQ NRDGYSFMGN QTNFIGGFGQ YPMEEIGRFD AEQFTPRFSG NGVSLTLGLP  600
HCETLSGTHQ TFLPSQNIQL GRGLDIGEPN QFGALNNSNS HSSTAFESIN MQNPKRFAAQ  660
LLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-167TALE family protein