PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027366825.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 305aa    MW: 34698.1 Da    PI: 4.7727
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027366825.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092492812355
                     SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  XP_027366825.1 249 PYPTEEEKVQLSEMTGLDQKQINNWFINQRKRH 281
                     8*****************************885 PP

2ELK37.26.2e-13201222122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKY+gyL+sL++EF+
  XP_027366825.1 201 ELKEMLLRKYGGYLSSLRKEFL 222
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    
MEDIYKLNPL LSCSEDVVVR DHVNVNASAT AASELHLGLV ANNYLRMEEP SEPDVSDRLI  60
KTQIASHPLY PNLVSAYIEC QKVGAPPELA SLLEEIARES HPTDALREIG DDPELDEFME  120
SYCEVLHRYK QELSKPFNEA TLFLCSIESQ LSNLCKGTLT LSSDNNRSDE AAGTSEDELS  180
FEKVEAIEGH EFSGTRPGDQ ELKEMLLRKY GGYLSSLRKE FLKKRKKGKL PKDARIVLMD  240
WWNTHYRWPY PTEEEKVQLS EMTGLDQKQI NNWFINQRKR HWKPSEDMRF AIMDGVSGGG  300
IGGPM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217226LRKEFLKKRK
2223227KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.14e-81TALE family protein