PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027362888.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 374aa    MW: 41926.6 Da    PI: 5.7461
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027362888.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.6e-073123442254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_027362888.1 312 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 344
                     59*****************************87 PP

2ELK29.51.7e-10265286122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+ +++++++E++
  XP_027362888.1 265 ELKHELKQGYKDKIVDIREEIL 286
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    
MAFHDHLPHE ITFQPFTDEQ QLGQSRDMQR LLPLSAASGG GGAGPTWLNS NAATLRQQNF  60
LHLQPDSTAH QNDDVRGSMM GSEKSLDRNR TESNSEPDAL AEYKADILGH PLYDQLLSAH  120
VSCLRIATPV DQLPRIDAQL QQSQRVVDKY SGLGNGVVDD KELDQFMTHY VLLLCAFKEQ  180
LQQHVRVHAM EAVMACWELE QSLQSLTGVS PGEGTGATMS DDEEDQAESN ANLYEGSLDG  240
ADSLSFGPLV PTESERSLME RVRQELKHEL KQGYKDKIVD IREEILRKRR AGKLPGDTTS  300
LLKAWWQSHS KWPYPTEEDK ARLVQETGLQ LKQINNWFIN QRKRNWHTNP SSSSGSKSKR  360
KSSGAGETSN QSFM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-161TALE family protein