PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027361904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 314aa    MW: 35725.3 Da    PI: 4.8782
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027361904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.7e-102572912155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++ eLAk++gL+++q+ +WF N+R ++
  XP_027361904.1 257 KWPYPTEADKIELAKSTGLDQKQINNWFINQRKRH 291
                     569*****************************885 PP

2ELK34.54.3e-12211232122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrK+++++gsLk+EFs
  XP_027361904.1 211 ELKDRLLRKFGSHIGSLKHEFS 232
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    
MDEMYGVPST AEYADKALMT PENLIFPPDY PNFYMSSSAA ARIPMFGSDE LLSAEPSSAV  60
GIQRQEEDDV ATTIMKAKIA SHPHYPRLLQ AYIDCQKVGA PPEIARLLEE IRRENDLCKR  120
DVVSTCFGAD PELDEFMETY CDMLVRYKSD LARPFDEATT FLNKIEMQLS NLCTGASVPT  180
LSDDGGVSSD EDFSTGDGDA QDGQIKGEDR ELKDRLLRKF GSHIGSLKHE FSKKKKKGKL  240
PKDARQILLQ WWSVHYKWPY PTEADKIELA KSTGLDQKQI NNWFINQRKR HWKPSENMQF  300
SMMENLNGRF LADD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-132TALE family protein