PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027359964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 287aa    MW: 32734.1 Da    PI: 6.9671
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027359964.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-072362692154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_027359964.1 236 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 269
                     469*****************************87 PP

2ELK25.53e-09190211122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_027359964.1 190 ELKIELKQGFKSRIEDVREEIL 211
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    
MQEPNLGMMG GLSGEVSGDH HRQLKAEIAS HPLYEQLLAA HVACLRVATP IDQLPLIDAQ  60
LSQSHHILRS YVSHHTQAHS LSPHHRQELD NFLAQYLIVL CTFKEQLQQH VRVHAVEAVM  120
ACRDIENTLQ ALTGVSLGEG TGATMSDDED DMPMDFSLDQ SSAEGHDMMG FGPLLPTESE  180
RSLMERVRQE LKIELKQGFK SRIEDVREEI LRKRRAGKLP GDTTSVLKNW WQQHAKWPYP  240
TEDDKAKLVE ETGLQLKQIN NWFINQRKRN WHSNSQSVTS LKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267287RKRNWHSNSQSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-174TALE family protein