PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027359713.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 747aa    MW: 80985.1 Da    PI: 7.2854
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027359713.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095165531954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_027359713.1 516 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 553
                     664459******************************88 PP

2BELL120.95.5e-39376447172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ ++g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  XP_027359713.1 376 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSRHFRCLKDAITAQL 447
                     589******************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    
MGIATPPLSS ILSHSNKHDS SNSMSQDYQQ GIFSFSNGFE RSSTVGPQQQ IRREKARFEA  60
AAPPPLVGIE EEEPGGIPVY ESAGMLSEMF NFPPAGGELL EQQQPVTASF RAARQPGEWY  120
GNRQLGVMNM MSGLGDSKNQ NGAHSREGLV QNQISSINAE SAAAMQLFLM NPQTRSPSPP  180
QNHAPPSSTL HMLLPNPSSN SLQGFTGSAP GGSFGQFTWV PDSAHQEGGV VEGQGLSLSL  240
SSSLEAAKAE ELRMGDSGFL YYNHQQGPSS SSSAAQFQYK NNNHHLQGAI AHNNHHQGHV  300
GFGSSSLGVV NVLRNSKYVK AAQELLEEFC SVGRGQFKKN KFNRQNSNPN SNPGGGAASS  360
SSSKDAPPPP PLSAADRIEH QRRKVKLLSM LDEVDRRYNH YCEQMQMVVN SFDLMMGFGA  420
AVPYTALAQK AMSRHFRCLK DAITAQLKHS CELLGEKDGA GTSGLTKGET PRLKMLEQSL  480
RQQRAFHQMG MMEQEAWRPQ RGLPERSVNI LRAWLFEHFL HPYPSDADKH LLARQTGLSR  540
NQVSNWFINA RVRLWKPMVE EMYQQELKEA ESAEEREKNE SNSNSGHLAQ TPTAAAAATT  600
STATAPPPPT TTTTTTKPTG KRSDINATES DPSLVAINRQ GFSENKAKQS TTSTTTTTTI  660
NATASEVAPP VSQCFDSDLP PHRSIASDDT CRLVTADYGT ASASADIGST LIRFGTTPGD  720
VSLTLGLRHA GNMPEKTPFS VRDFGAI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-154TALE family protein