PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027359685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 647aa    MW: 72094.2 Da    PI: 6.7087
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027359685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.2e-094174541954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_027359685.1 417 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 454
                     554459******************************88 PP

2BELL117.37.1e-38279349272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + elqk+k+kLls+leeVd+rYk+y++q++ v+ssFeavag g+a++Y +lAlka+SrhFrcLkd i +qi
  XP_027359685.1 279 FVELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGILGQI 349
                     679******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    
MARQLCEDKS SGGFCYSDAS SGNPTMQTHL VNQIQGFVSD PEMFNLTTGM EMIGFPKGDA  60
NAVMWKTFSA KPGPSSSKTM NHSSTTFYHH DYNNKPSDFT QAISETSGEN LIVGAHDSAP  120
WQENNNRLLV DDSSLRCVFP CEGNERPSQG LSLSLSSTNP STIGLQSFEL RQTSHHPDFV  180
STSREGFFGK SVTVQQQQVL QDGYLSAKPA NLYQQGHFLL KNSKYLVPAQ DLLNEFCSLG  240
TKQSEVPKPK SSNKNKQWEE DNNNGVGSSK KHSLTSLEFV ELQKRKTKLL SMLEEVDRRY  300
KHYRNQMKSV VSSFEAVAGN GAATVYSALA LKAMSRHFRC LKDGILGQIQ ATRKAMGEKD  360
PVAPGTTRGE TPRLKIIDQA LRQQRAFQQM SMMETHPWRP QRGLPERSVS VLRAWLFEHF  420
LHPYPSDVDK HILARQTGLS RSQVSNWFIN ARVRLWKPMV EEMYLEELKD QENNIASSEA  480
GTDPDDNINP NVQNPPPASS RSEDQKPTLV RIDSECASSV INNHTPDNKN DPKNSTNMNP  540
QEQCFGSVEL DFSSYTHHTS GMVSYSSNDH DGNNQSLNGG NGVSLTLGLQ QHGVSLAFPP  600
TTQSSLYYPR DQIEDCQPVQ YSLLDGEGQN LPYRNLMGAQ LLHDLAG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-141TALE family protein