PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027356932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 358aa    MW: 41259.2 Da    PI: 6.8661
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027356932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-092863202155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_027356932.1 286 KWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 320
                     669*****************************885 PP

2ELK35.71.9e-12240261122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_027356932.1 240 ELKNRLLRKYSGYLSSLKQELS 261
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    
MEEYTNNHPS PRANLLYSLA GGSSGGSNCH HQLPMNTFHL QSGGSDHCFQ SDQEPHPSVK  60
TESNNSHLRS PIFHYPLMRT NLHHTQQGGS QSSNELEAIK AKIIAHPHYS NLLEVYMDCQ  120
KVGAPPEVVA RLAAVRRDFE APQRSSVRSR EGCKDPELDQ FMEAYCDMLA KYREELTRPI  180
QEAMDFMRRT ETQLNMLCNG TVRIFSDDKC ENIGSSEEDQ DNSGGETELP EIDPRTEDRE  240
LKNRLLRKYS GYLSSLKQEL SKKKKKGKLP KDARQKLLSW WELHYKWPYP SESEKVALAE  300
STGLDQKQIN NWFINQRKRH WKPSEDMQFM VMDGLHTQNT ALYMDAHYMV DGHYRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-143TALE family protein