PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027356929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 563aa    MW: 62138.5 Da    PI: 6.5479
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027356929.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-084815191854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  XP_027356929.1 481 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 519
                     5887779******************************88 PP

2BELL75.96.2e-25352421171
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                     +r++ ++kka+Ll+ll+ Vd+rY+q+ ++++tv+s+F+a+++l+s ++++++Al++iS  ++ L+++i++ 
  XP_027356929.1 352 QRHAAESKKAQLLTLLQLVDNRYSQCLDEIHTVVSAFHAATELDS-QIHAHFALQTISILYKDLRERISNY 421
                     68999***************************************9.**********************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    
MESDMYKISG RASNVIDGIS QHSTSNPLIQ CYSVDLNNQS HIINGISMLS GEQGGPLSNV  60
HAEDCFTNSA NIADSSSLVT SRGKTIVGDA SNPMENTEFQ DHLVGGMPIT PASLAAILAA  120
RIGLQENLEN SAALPRSLCS MGALGPFFNN SQDTSNPLPT TFEDCGYDEV PNKWNANKFS  180
KAPEIDGTGC QPYSSIGNLD PGGWASSNVA NIINHSYHSS NFSNELSLSL ATSTTPGQCS  240
EVSCSDVTPC MNGTVSGLEQ ASCSSSREFS MSLSGNKYVQ FSPEVLGSRY LAGIQEILAQ  300
IARYSFENLE QINYGSRAGG SKSTLTFPPN GKILTNHKAN SMHEAHAESP LQRHAAESKK  360
AQLLTLLQLV DNRYSQCLDE IHTVVSAFHA ATELDSQIHA HFALQTISIL YKDLRERISN  420
YILAMGSNFN DLCSEEKEWS VETSFLQKQW PLQHLKRKDH QLWRPQRGLP ERSVSVLRAW  480
MFQNFLHPYP KDAEKHLLAV KSGLTRSQVS NWFINARVRL WKPMIEEMYA EMNKRKACRN  540
EEGMQSNHGN RIGMSSNQRF NVN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-107TALE family protein