PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027354710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 436aa    MW: 48566.9 Da    PI: 6.2802
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027354710.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073734062154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_027354710.1 373 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 406
                     469*****************************87 PP

2ELK28.82.9e-10327348122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_027354710.1 327 ELKHELKQGYKEKIVDIREEIL 348
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    
MAYHNHHMSQ DLPLPHFTDQ QQHPHPDNTL LATSSDPTSK PPSDPHQTAP NWLNNALLRT  60
HFTENNNNHA NSASNNNGTN FLNLHTAASD PAANQSSGQW LARPVLHRNR SEVIDDVAGA  120
GESMMAGATV SHESADLKRG VEKSEAVAAE SGGEGLMNWQ NARHKAEILA HPLYEQLLSA  180
HVACLRIATP VDQLPRIDAQ LAQSQNVVAK YSAFGQGIVG DDKELDQFLS HYVLLLCSFK  240
EQLQQHVRVH AMEAVMACWE IEQSLQSLTG VSPGEGTGAT MSDDEEDQVD SDANLFDGAL  300
DGPDSMGFGP LIPTENERSL MERVRHELKH ELKQGYKEKI VDIREEILRK RRAGKLPGDT  360
TSVLKAWWQS HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS NPSTSTVLKS  420
KRKRCNAGDN SGDLYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1404424RKRNWHSNPSTSTVLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0TALE family protein