PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027354608.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 552aa    MW: 60714.5 Da    PI: 6.2343
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027354608.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092933301954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_027354608.1 293 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 330
                     664459******************************88 PP

2BELL118.72.6e-38157227272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +q+l++k +kLls+l+eVd  Ykqy++q+q+v+ssF+++ag g+akpYt+lAl++iSrhFrcL dai++qi
  XP_027354608.1 157 KQDLHNKLTKLLSMLDEVDSGYKQYYHQMQIVVSSFDVIAGSGAAKPYTALALQTISRHFRCLHDAITGQI 227
                     789*******************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    
MPSGVQMPSI HDRNQSSSFD SFLATNPSIL GNGAYKSGLS RNDGMRHSEN FPSGSPEVSQ  60
DLNRGDFSLH GMSSLGRTVP NSKYLKAAQQ LLDEVVDIRK AIKRPGMMRS HSTHGNCRKN  120
SREDDELLEY EGPSANGVPN SQASASNSSC ELSHADKQDL HNKLTKLLSM LDEVDSGYKQ  180
YYHQMQIVVS SFDVIAGSGA AKPYTALALQ TISRHFRCLH DAITGQISAI QKNLGEQDAS  240
GSNKGVGIAR LRYVDQQIRQ QRALQQLGMT QHAWRPQKGL PDSSVSILRA WLFEHFLHPY  300
PKDSDKIMLA RQTGLTRSQV SNWFINARVR LWKPMIEEMY KQENCDADMN SSSSSENASK  360
VTKSDVKTSN DMGDDSQQSQ SPIIADKNHS GGQPKDPRYD QVLDTEIMAS TGLTSLIYGG  420
HETETEYRSL KLTEEQKPNL DDCGLFSDDM AVLSDGANNR FVAAGLTCQM SEFGRFKSGS  480
GVSLTLGLQH CERGNFLPGE THLGLVSMRE DDIYNAAAAS TIGADTAELE CIGAGNQQQR  540
FSSPCILHDF EV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-113TALE family protein