PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027354606.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 647aa    MW: 70979.8 Da    PI: 6.1097
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027354606.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-093884251954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_027354606.1 388 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 425
                     664459******************************88 PP

2BELL118.43.3e-38252322272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +q+l++k +kLls+l+eVd  Ykqy++q+q+v+ssF+++ag g+akpYt+lAl++iSrhFrcL dai++qi
  XP_027354606.1 252 KQDLHNKLTKLLSMLDEVDSGYKQYYHQMQIVVSSFDVIAGSGAAKPYTALALQTISRHFRCLHDAITGQI 322
                     789*******************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    
MATYYSSSCS SNQRDAVPIL CRRDPLPNSY PDTLYVNSAS YSQTFSANSQ QQNNCFVIPS  60
LGASHSTPQQ EEILANVSGF QTLQAQGLSL SLGTQMPSGV QMPSIHDRNQ SSSFDSFLAT  120
NPSILGNGAY KSGLSRNDGM RHSENFPSGS PEVSQDLNRG DFSLHGMSSL GRTVPNSKYL  180
KAAQQLLDEV VDIRKAIKRP GMMRSHSTHG NCRKNSREDD ELLEYEGPSA NGVPNSQASA  240
SNSSCELSHA DKQDLHNKLT KLLSMLDEVD SGYKQYYHQM QIVVSSFDVI AGSGAAKPYT  300
ALALQTISRH FRCLHDAITG QISAIQKNLG EQDASGSNKG VGIARLRYVD QQIRQQRALQ  360
QLGMTQHAWR PQKGLPDSSV SILRAWLFEH FLHPYPKDSD KIMLARQTGL TRSQVSNWFI  420
NARVRLWKPM IEEMYKQENC DADMNSSSSS ENASKVTKSD VKTSNDMGDD SQQSQSPIIA  480
DKNHSGGQPK DPRYDQVLDT EIMASTGLTS LIYGGHETET EYRSLKLTEE QKPNLDDCGL  540
FSDDMAVLSD GANNRFVAAG LTCQMSEFGR FKSGSGVSLT LGLQHCERGN FLPGETHLGL  600
VSMREDDIYN AAAASTIGAD TAELECIGAG NQQQRFSSPC ILHDFEV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-113TALE family protein