PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027353848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 445aa    MW: 50119.1 Da    PI: 6.0578
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027353848.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.2e-103694061954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt++qV++WF N R +
  XP_027353848.1 369 FEHflHPYPNDSEKLMLASQTGLTKNQVSNWFINARVR 406
                     554459******************************88 PP

2BELL102.62.9e-33232302272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     ++e+q+k+a+L+sll+eV+ r ++y++q++ v++sFe++aglg+ak Yt+lAl+a+SrhF +L+dai +qi
  XP_027353848.1 232 KHEHQIKIARLISLLDEVESRCEKYYHQMEEVVASFEMIAGLGAAKCYTALALQAMSRHFCSLRDAILSQI 302
                     79*******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    
MSNSITHQNH FENQELDAYG SSMRNNNAFP ESIGAFPSIQ SIGERISRSV DLVQGLAEGS  60
EISHTRHLMD LLGAANESNH HQLQGLSLSL GSHMLVPSDE YRHQRTLNPG LMNPNYFIPG  120
QEAREACNPA VEHLTSDYFF TSGSGTFASS SAPLNRSPST SYGAESFTSV IGNSRYLKPV  180
QSLLEDLVDV GGNVVDRINE KYAEKLFHGS RRTLSSELKA ELRNNEPLLS DKHEHQIKIA  240
RLISLLDEVE SRCEKYYHQM EEVVASFEMI AGLGAAKCYT ALALQAMSRH FCSLRDAILS  300
QINAEKRKLF QDLPKISSGL SQLSLFDRDT RHSRVSLQQL GVIQSQRQVW RPIRGLPETS  360
VAILRSWLFE HFLHPYPNDS EKLMLASQTG LTKNQVSNWF INARVRLWKP MIEEMYKEEF  420
GDSSEDSNTA ANYMTREDTT DCVED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-108TALE family protein