PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027353845.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 597aa    MW: 65934.9 Da    PI: 6.4175
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027353845.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093934301954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  XP_027353845.1 393 FEHflHPYPKDSEKIMLARQTGLTRNQVANWFINARVR 430
                     665559******************************88 PP

2BELL126.31.1e-40264335172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erq+l  kk+kLls+l+eVdkrY+qy++q+q+v+ssF++vag+g+a+pYt+lAl++iSrhFrcL+dai++qi
  XP_027353845.1 264 ERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMVAGCGAAEPYTTLALRTISRHFRCLRDAISGQI 335
                     6899999****************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    
MYPNQAFSSG SYADMMSGSS LLAHNYNESV GGQNGVKFIT AMGDTVTMQS IDGHSNAATG  60
DPACNSFAGD SPVVPRTQMG IVDREQNMQC QGLSLSLGTL MPSTASVPSF QYQYPDTGLL  120
PLMTDCLPNL KGTMSLKDDE ANLHKELRSA AECMASVSSG GFHDITKREG FYNPHPSMCL  180
KEVHSDPCLQ GSPGFSNSVL NSQYLKAAQE LLDEIVNVRK ALKQPGMEKQ ENCRDIGKDS  240
SKDSDGKSAN GSTANPSCEL SPGERQNLLD KKTKLLSMLD EVDKRYRQYC HQMQIVVSSF  300
DMVAGCGAAE PYTTLALRTI SRHFRCLRDA ISGQIQVTQR SLGEQEGIPR LRYVDQQLRQ  360
QKALQQLGVM RQAWRPQRGL PESSVSILRA WLFEHFLHPY PKDSEKIMLA RQTGLTRNQV  420
ANWFINARVR LWKPMVEEMY KEEFGDSEMN CNLSSENNGK ELERGVHVEN GVMDSGTRKL  480
QGNQNQRLGM NHSSSNLYVA TNQNGDGSLM GSSTAAAATY DLSELGNFTV GGHVSLALEL  540
RNCESDGFAM SDDAIHKRRN QTLASSPDAD LLDYHFTDSG KQQHRFGNPH LLHEFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-110TALE family protein