PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027353291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 683aa    MW: 74105.3 Da    PI: 7.0948
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027353291.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093864231954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_027353291.1 386 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 423
                     554459******************************88 PP

2BELL123.77.5e-40250321172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+s+l+eV++rY+qy++q+++v+ssFe++ag+gsa+ Yt+lAl++iS++FrcLkdai++qi
  XP_027353291.1 250 ERQEIQMKKAKLISMLDEVEQRYRQYHHQMEIVVSSFEQAAGIGSARTYTALALQTISKQFRCLKDAITGQI 321
                     79*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    
MATYFHGNSE IPSGGADGLQ TLVLMNPGYI HYSDAPPQPP PSHAAGNLVF LNAATVASNN  60
NSFSSHAPPS HTQQFVGIPL PASQDLNHHS MHAHHDVSAL HGFLPRMQYN PWNAIDPNSA  120
ARDTPRAQQG LSLSLSSQQA GFGSFREGQA PAMSSDELRV SGGSPSSASG VTNNGASGIQ  180
SVLLSSKYLK ATHELLEEVV NVNNGIGTEL AKKSGGQSKV IGESSAAASG DGSVGGEGSG  240
KRSSELSTAE RQEIQMKKAK LISMLDEVEQ RYRQYHHQME IVVSSFEQAA GIGSARTYTA  300
LALQTISKQF RCLKDAITGQ IRAANKSLGE EDCFGGKIEG SRLKYVDHHL RQQRALQQLG  360
MIQHNAWRPQ RGLPERSVSV LRAWLFEHFL HPYPKDSDKH MLAKQTGLTR SQVSNWFINA  420
RVRLWKPMVE EMYLEEMKEH EQNGSEDKSS KSNDDSSMKM AAPQEKGPTN ETEAKSFSSK  480
QDVSKSQNTP IVSVSRPSTS PLGGNVRNQS GFSFIGSSEL EGITQGSPKK PRNHEIVHSP  540
NGIPSINMDV KPNEGNNEQL SMKFGEERQG RDGSSFMGNQ TNFIGGFGQY PIGDIGRFDA  600
EQFTPRFSGN GVSLTLGLDS LPGTHQTFLP NQNIQLGRSL DIAEPNEFGA INTSSPHSTA  660
AYESINMQNP KRFAAQLLPD FVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-151TALE family protein