PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027350847.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 311aa    MW: 34956.6 Da    PI: 6.5143
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027350847.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.6e-092562892255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  XP_027350847.1 256 WPYPTEEEKVKLSEITGLDQKQINNWFINQRKRH 289
                     48*****************************885 PP

2ELK29.31.9e-10210230222
             ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                     LK++LlrKYsg+ +sLk+EF+
  XP_027350847.1 210 LKEMLLRKYSGHFSSLKKEFL 230
                     9*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    
MEAVYRWKPP LSCPEDVVRV GNASVSATTT ATTTSELRLG SAEANCYLQL EAPAERNVTG  60
SDMSDRLIKI QIANHPLYPD LLAAYIGCQK VGAPPELISL LEGIARESHS MNAHREIGNG  120
PELDEFMETY CEVLHRYKEE LSKPFNEATL FLGNMESQLS NLCQGTLAKS SDNNRSAGGA  180
SEEELSCGEM EAVESHVSSS SGTCPGDQKL KEMLLRKYSG HFSSLKKEFL KRRKKGKLPR  240
DARMALMDWW NTNHRWPYPT EEEKVKLSEI TGLDQKQINN WFINQRKRHW KPTEDMRFAI  300
VDGGRGGPMF L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.11e-78TALE family protein