PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027350777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 596aa    MW: 65786.4 Da    PI: 7.3789
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027350777.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093924291954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  XP_027350777.1 392 FEHflHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 429
                     554459******************************88 PP

2BELL1055e-34265331672
            BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +kkk +Ll++l+eV++rY+qy++q+++v+ sFe vaglg+a+pY+slA +a+S+hFrcLk+ai++q+
  XP_027350777.1 265 RKKKCRLLTMLDEVYRRYRQYYQQMHAVVTSFEYVAGLGNAAPYASLAINAMSKHFRCLKNAITDQL 331
                     79**************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    
MAEGFEHYHV PQQSRRDKLR VFAQNQPGFV ESSSTLHPAC ATLPSLYDPS LISSDLLACA  60
NQQGHGFHSN QNEACKGNQG GGAKEEGSNL MMGFAGGVVN SSSNPFLYQA QGLQNLREFD  120
SSYNDGGEML VFKPEPLSLS LSSHNSNNTH HPLELNLQRY GSVIYGDKVG GGCVIPGLVG  180
GNSEVSRNSV PLGPFTGYAS ILKESRFLKP AQQLLGELCD VGVRGIYATE KIAPDASLME  240
PPHESLSASG IGGDDPLGEY GNDGRKKKCR LLTMLDEVYR RYRQYYQQMH AVVTSFEYVA  300
GLGNAAPYAS LAINAMSKHF RCLKNAITDQ LQFINKAHFQ ISNRKDESPR FQNSDRGTYS  360
QRPAFLEHQQ PVWRPQRGLP ERAVSVLRAW LFEHFLHPYP TDTDKLMLAK QTGLSRNQVS  420
NWFINARVRL WKPMVEEIHM LESQQAQKKS QREEHSRNNL SDQMPSDNSL VTENPSTSTG  480
KFQDVPYNRT RNELANMQVR SQEQLNQNNT SNHQQVGVGV SMGSGGGASN NGVSLTLGLH  540
QNHGIGLSEP FSMSAAQRFG VALQPEGYVI SGFESQNRHF GRDVIGGGQL LHDFVG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264271GRKKKCRL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-109TALE family protein