PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027347930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 732aa    MW: 79797.7 Da    PI: 7.3841
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027347930.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-094394761954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_027347930.1 439 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 476
                     664459******************************88 PP

2BELL122.22.2e-39303374172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rqelq+kk+kL+++l+eV++rY+qy++q+q+vissFe+vag+g+ak+Yt+lAlk+iS++FrcLkd i++qi
  XP_027347930.1 303 QRQELQMKKSKLVNMLDEVEQRYRQYHHQMQIVISSFEQVAGIGAAKSYTALALKTISKQFRCLKDSISSQI 374
                     69*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    
MATYFHGSNS EIQSSAEGLQ TLYLMNPNYV PYSDAAQHPT QNMLLVNPNT TNNTTTIPSH  60
ALNLANFSHA PPSPSPNNHH RHHEQQPLIG VTFPSSNILG SNTTDDPTRP AFLGQPEIPA  120
FHGLTATAAT TAAVPRVHYN LWGSIMDQSV STAAVAAVHT PSNSAGCVAA VTNVSRQIGF  180
HRPNNQLSLS LSSQHTPYRS FSGEVQAISP ASRGGDDMRV VNNGVSSMHS VVLGSKYLKA  240
AQEVLDEVVN VGKGISKEEE SMEGAKREKM KGNIESTSRV GDGSSGGGES SGGKQGAELS  300
TAQRQELQMK KSKLVNMLDE VEQRYRQYHH QMQIVISSFE QVAGIGAAKS YTALALKTIS  360
KQFRCLKDSI SSQIRTTTKT LGEDDCLGVK VEGSRLRYVD HHLRQQRALQ QLGMIQHNAW  420
RPQRGLPERA VSILRAWLFE HFLHPYPKDS DKVMLAKQTG LTRSQVSNWF INARVRLWKP  480
MVEEMYLEEV KQEDNGSQDN NTNRSKESGK ELWTEASAAQ DSSAMRLDQI NVFQSKAESF  540
NNQTTSPTEI SNSNSMSTSP MGGEGGGGSL QSQSGFHLPG MQSPKRPRSA SELQNSPGSI  600
LSVDMEMKSH GEANNRDSNT KFGIENHGGG FGAFSMEDIG RFNVTEQLAP RFHGNGVSLT  660
LGLPHSETLP LSGTQHGFLS QNMHLGMGNN ENEFCGAINT PPSSHSGTSY ESIDIQNRKR  720
FAAAQLLRDF VA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-116TALE family protein