PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027346016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 763aa    MW: 84509.3 Da    PI: 6.9703
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027346016.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-095585951954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_027346016.1 558 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 595
                     665559******************************87 PP

2BELL102.14.1e-33415483472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + qk kakLl ++eeV +rYkqy++q+q+v+ sFe vagl sa+pY+slAlk +S++FrcLk ai++q+
  XP_027346016.1 415 ACQKNKAKLLYMQEEVTRRYKQYHQQMQMVVQSFESVAGLSSATPYISLALKSVSKNFRCLKSAISDQL 483
                     7899**************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    
MSSLRPELHV AQQIRRDKLR IQNSSQHFQE FPNNLEQLTL HPGFNLDLLP VRNNVRNGNM  60
LDAEEALYPS EMISFSTASN PLSAPRNPLE CTQELMMAQY GSFPHSSAKE QCEPRNNLGN  120
WRNSAPHQVS DWMVNYNESN PNSFLTSELN NNREIQKQLG EMHYTPSSSS PLYHNALQDM  180
ASLMHDGVWG GNHGEPVVHP SFGHQANSEF RFGSANLWTN SSMGFTDKKV VNEQDTNPQG  240
LSLSLSSNSQ SKPSFEEGSA SDDPQYSKSV KTTMKPNVNI PRSCGKSLQD SMVMPLNNSA  300
TYRNVGPLGP FTGYATILKS SKFMKPCQQL LDQWCCHNGS KFTKGGACDV VPEWVSRDVS  360
AASTSAADAV SVDESGVAAK GVGISGASSS VLYSSNENSA DGGAASSFCL SSRPACQKNK  420
AKLLYMQEEV TRRYKQYHQQ MQMVVQSFES VAGLSSATPY ISLALKSVSK NFRCLKSAIS  480
DQLKLTCEVL GEDFSLPTTS TSNKFDTNMA RLRYMDQSFQ KNKSGGPNVD FLEPQQHVWR  540
PQRGLPERSV AILKAWLFEH FLHPYPTDTD KHMLATQTGL SRNQVSNWFI NARVRVWKPM  600
VEEIHMLETK GAAEAHQNTS KNNDQVASAS EGSNQPKVDH QPVNKFGTHA HARAIAEKQF  660
QCLEMGSSSS AGNEENIGMD GEQWNEEKRS KLECQINTTP SLDGTVMGFM PYRRGGLEVG  720
GIGSVSLTLG LRHGVEGVQQ QQLHQEDELR RQFGGHMIRD FVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.17e-82TALE family protein