PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027345650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 750aa    MW: 81349.2 Da    PI: 7.2352
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027345650.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095325691954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_027345650.1 532 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 569
                     664459******************************88 PP

2BELL120.86.1e-39392463172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLl++l+eVd+rY++y+eq+++v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  XP_027345650.1 392 DRIEHQRRKVKLLTMLDEVDRRYSHYCEQMHMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAISAQL 463
                     589******************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    
MGIATPSSLP SILSKTHQHQ QQHHLNSMSQ DYHHHHHQGI FNFPNGFERS TTVTQEQQQQ  60
QQQIRREKVR VQGFEPQQTT LVPIEEEESG SLPVYENEGM LSEMFNFGAG GAELLEQQPQ  120
SMTTTFRSST RTVGSGGSEW YGNRQGMLTG LGPLGDSKNH HHHQMSNINA DPAAAMQLFL  180
MNPQTRSPSP PPPSASSSTL HMLLPTFPPG STTGGSFGQF SWVPDTSQEG GTSTVVEGHG  240
QGLSLSLSSS LEAAKAEELR MGDSGFLYFN QASGGGPSSS AQYPYKNLAG HHHQALHIQQ  300
GGIGQNQQGH VGYGASSSTP SLGVVNVLRN SKYVKAAQEL LEEFCSVGRG QFKKNKFSRQ  360
LSNPSSNPGA SGGGGGGSYS SSKDVPPLSA ADRIEHQRRK VKLLTMLDEV DRRYSHYCEQ  420
MHMVVNSFDL VMGFGAAVPY TALAQKAMSR HFRCLKDAIS AQLKHSCDLL GEKDGAGTSG  480
LTKGETPRLK LLEQSLRQQR AFHQMGMMEQ EAWRPQRGLP ERSVNILRAW LFEHFLHPYP  540
SDADKHLLAR QTGLSRNQVS NWFINARVRL WKPMVEDMYQ QELKEAEGAE ERERNQSSSN  600
SGHQAAQTPT PSTTASTATA PPPTASPPTT IATAPTGKRS DINAQDSDPS LAAINNRHQA  660
NSTATTVAAT ASEVVPPSEL PPHNNTDETC RHGSLVTTTD YGTASATSDI GSTLIRFGTT  720
AGDVSLTLGL RHAGNMPEKT PFSVRDFGAI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.21e-143TALE family protein