PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027345649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 777aa    MW: 84613.5 Da    PI: 7.3848
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027345649.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-095595961954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_027345649.1 559 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 596
                     664459******************************88 PP

2BELL120.76.4e-39419490172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLl++l+eVd+rY++y+eq+++v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  XP_027345649.1 419 DRIEHQRRKVKLLTMLDEVDRRYSHYCEQMHMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAISAQL 490
                     589******************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    
MGIATPSSLP SILSKTHQHQ QQHHLNSMSQ DYHHHHHQGI FNFPNGFERS TTVTQEQQQQ  60
QQQIRREKVR VQGFEPQQTT LVPIEEEESG SLPVYENEGM LSEMFNFGAG GAELLEQQPQ  120
SMTTTFRSST RTVGSGGSEW YGNRQGMLTG LGPLGDSKNH HHHSRDSSSS SSMVQHQHHH  180
HHHNHHHHHH QMSNINADPA AAMQLFLMNP QTRSPSPPPP SASSSTLHML LPTFPPGSTT  240
GGSFGQFSWV PDTSQEGGTS TVVEGHGQGL SLSLSSSLEA AKAEELRMGD SGFLYFNQAS  300
GGGPSSSAQY PYKNLAGHHH QALHIQQGGI GQNQQGHVGY GASSSTPSLG VVNVLRNSKY  360
VKAAQELLEE FCSVGRGQFK KNKFSRQLSN PSSNPGASGG GGGGSYSSSK DVPPLSAADR  420
IEHQRRKVKL LTMLDEVDRR YSHYCEQMHM VVNSFDLVMG FGAAVPYTAL AQKAMSRHFR  480
CLKDAISAQL KHSCDLLGEK DGAGTSGLTK GETPRLKLLE QSLRQQRAFH QMGMMEQEAW  540
RPQRGLPERS VNILRAWLFE HFLHPYPSDA DKHLLARQTG LSRNQVSNWF INARVRLWKP  600
MVEDMYQQEL KEAEGAEERE RNQSSSNSGH QAAQTPTPST TASTATAPPP TASPPTTIAT  660
APTGKRSDIN AQDSDPSLAA INNRHQANST ATTVAATASE VVPPSELPPH NNTDETCRHG  720
SLVTTTDYGT ASATSDIGST LIRFGTTAGD VSLTLGLRHA GNMPEKTPFS VRDFGAI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.21e-143TALE family protein