PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027343378.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 803aa    MW: 88541 Da    PI: 6.8977
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027343378.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-096136501954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_027343378.1 613 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 650
                     665559******************************87 PP

2BELL98.65.2e-32469538372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      + q+kkakLl ++eeV ++ kqy++q+q+v+ssFe vagl sa+pY+slAlk +S+hF+cLk  i+eq+
  XP_027343378.1 469 LDYQQKKAKLLYMQEEVTRQCKQYHQQMQMVVSSFESVAGLSSATPYISLALKSVSKHFKCLKHSISEQL 538
                     5789****************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    
MSGSRPECHV AQEIRREKLR IHNSSQHLHE FPSNLEQLSL HPGFNLGLVE VRNVRNANML  60
DEPEPAVFSS EMPNFSTASN PLGAPRNALE YHQELGAAEP SSRLMMNNQY GSFPHSISAI  120
HSSQKEQCEL RNFGNWRNSA SHQGSDWFVN YASSSLVNGS NAIANSFLVS ELDNVAGYNE  180
LNVQFGNASD EMGGTEIHKQ LGGSQNPPPS SSPLFQNALQ DIVKSASISA HGQDMASLTQ  240
QNGHGVWVGN ASGVEIQPSY VNQPNQLRFG WTNRTIDNTM MNDSNPQSLS LSLSSNAQSK  300
PSVSQIEERS ASDDLQSGCG NISKDPQCLK HMKSIVKPSM ISRDCGKSLF QDTVGMHSKS  360
TSYRNVGPLG PFTGYATILK NSRFLKSAQQ LLDEICCFSD SKLAKACDVS ERVYGEVSAS  420
TSIDTVTVNE TGVTAIGCNS GSSPSMLYIS KENRAVWGVG SSFGLSSRLD YQQKKAKLLY  480
MQEEVTRQCK QYHQQMQMVV SSFESVAGLS SATPYISLAL KSVSKHFKCL KHSISEQLKL  540
ISEVLGEDSS IPKTSTSSKG DTNVARLRCM DQSFQKSKCG RGTTDFLEPQ QHVWRPQRGL  600
PERAVAILKA WLFEHFLHPY PTDTDKHMLA TQTGLSRNQV SNWFINARVR VWKPMVEEIH  660
MLETKVTGPK ENSNENVQTT STEGDTSQPR VDKPLSKFCG MNPVPENQFP SLEMSSSIAT  720
NTEEEWSQEK RSKLECQVTS NIDGTMMGFI PYRRGGLEVG GIGSVSLTLG LTHGVEGVQH  780
QQQLQEEHLR HHLGGHMIHD FVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-83TALE family protein