PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027342688.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 707aa    MW: 77044.9 Da    PI: 8.6721
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027342688.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.41.1e-084014381954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gL  +qV++WF N R +
  XP_027342688.1 401 FEHflHPYPKDSDKVMLAKQTGLARSQVSNWFINARVR 438
                     664459******************************88 PP

2BELL121.24.3e-39265336172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rqelq+kk+kL+s+l+eV++rY+qy++q+q++issFe++ag g+ak+Yt+lAlk+iS++FrcLkdai+ qi
  XP_027342688.1 265 QRQELQMKKSKLVSMLDEVEQRYRQYYHQMQVIISSFEQAAGFGAAKSYTALALKTISKQFRCLKDAISAQI 336
                     69********************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    
MATYFHGNTS EIQSSADGLQ TLYLMNPTYV PYTDAPHPPT PNMLLVNPNA LNLANLPHAP  60
SLSPSPNQQQ HLIQGVTSIL GSTNSGDHTR PSSFGNQENI TTFHGFSSSA AAAAPRVHYN  120
LWGQVIDQPS SAAATPSSSS GGGGFRRPSQ QGLSLSLSSQ QTAYRSVSGE VDVPGHVTGI  180
GNSPSSASNG VSGMHGVMLG SKYLKAAQEL LDEVVNVGKG IYREENKEKV KVNRESTTSG  240
VGGDGSSGGG ENSAGKQVVE LSTAQRQELQ MKKSKLVSML DEVEQRYRQY YHQMQVIISS  300
FEQAAGFGAA KSYTALALKT ISKQFRCLKD AISAQIKATS KTLGEDDCLG IKVEGSRLRY  360
VDHHLRQQRA LQQLGMIQPN AWRPQRGLPE RAVSILRAWL FEHFLHPYPK DSDKVMLAKQ  420
TGLARSQVSN WFINARVRLW KPMVEEMYME EMKEHEQANG SDNTRSKESS KELGSTANVA  480
PESISAIKLD HLQSKQESFN NRNTTSPTEI STNSSMSPIG GSLQSHSGNF HFAGSSDMQI  540
RSPNKPRNSE IQNSPSSILS VDMEMKHGEH ANREANKKFG IERHHKDGYP LMSGNTNHGG  600
GFGAFFMEDI GSRFNVTTEQ LASRFHGNGV SLTLGLPHNE NLPISGTQHG FLSQNIHLGR  660
RLEMGPNGNE FCAINTPPSS HSGTTYESID IQNRKRFAAQ LLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-128TALE family protein