PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027339756.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 659aa    MW: 73943.9 Da    PI: 6.4766
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027339756.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.4e-094284651954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_027339756.1 428 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 465
                     554459******************************88 PP

2BELL118.14.2e-38290360272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + elqk+k++Lls+leeVd+rYk+y++q+++v+ssFeavag g+a++Y +lAlka+SrhFrcLkd i +qi
  XP_027339756.1 290 FVELQKRKTRLLSMLEEVDRRYKHYCNQMKAVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGILDQI 360
                     679******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    
MAQQLCEDKS RDMASSTGFC YSDVSSANPT VQVQPHLMNH IQGFVTDPEM FNLTTGMEMI  60
GFSKNLQQQS ESNGVMWKSF FGKPSQHAGP SSSKTMNESS SSFYNPHEYN KQDFTSGISE  120
TSSENLIVGG AHDSAPWQEN RLIVDDSSLR CVFPCEGNER PSQGLSLSLS STNPSSIALQ  180
SFELRQSSHH QHQPDFVSSK EGFFGKSQQQ QMLQDGYFSS NKAANFYQGQ FLIKNSKFLV  240
PAQDLLNEFC SLGTKENDVP KPKYSQKNKQ WEEDNAGGSS KNHSLSSLEF VELQKRKTRL  300
LSMLEEVDRR YKHYCNQMKA VVSSFEAVAG NGAATVYSAL ALKAMSRHFR CLKDGILDQI  360
QATRKAMGEK DPVAPGTTRG ETPRLRIIDQ ALRQQRAFQQ INMMETHPWR PQRGLPERSV  420
SVLRAWLFEH FLHPYPSDVD KHILARQTGL SRSQVSNWFI NARVRLWKPM VEEMYLEEEK  480
EQQNNIASSE GGTNHEEDQN QSPSTRPEDQ KSTQASLLRI DSECVSSIIN NPDHKNDTKS  540
SKTIQNDHHM NPTDTFGSVE LDFSSYTHHS SGTVPYTTND HNANQSFHGG SGVSLTLGLQ  600
QHGAGGVSLA FPSATQNSLF YQRDQIEECQ TVQYSLLDGE GQNMPYRNLM GTQLLHDLA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-128TALE family protein