PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027338813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 366aa    MW: 40958.8 Da    PI: 6.6346
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027338813.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.3e-092923281955
                     HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_027338813.1 292 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 328
                     45679*****************************885 PP

2ELK41.13.7e-14248269122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_027338813.1 248 ELKGQLLRKYSGYLGSLKQEFM 269
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    
MEGSSNATSY LMAFGENSGG LCPMTMMPLV TSHHGAHHPI HPNNNSNTNA NTNCLFLPNC  60
SNSGSPSIML DNNHNTTNNN SNNAGLGYYF MESDHHHHHN NNGSSSSSSS SAIKAKIMAH  120
PHYHRLLAAY VNCQKVGAPP EVVARLEEAC ASAVTMAGEA AGSSCIGEDP ALDQFMEAYC  180
EMLTKYEQEL SKPLKEAMLF LQRIECQFKN LTISSSDIAC NDGADRNGSS EDDVDLHNII  240
DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLEWWS RHYKWPYPSE  300
SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVV DPSHPHYYMD NVLGNPFPID  360
LSNPML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264273LKQEFMKKRK
2270274KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-134TALE family protein