PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027337487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 291aa    MW: 33038.2 Da    PI: 6.703
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027337487.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092362702155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+ +++  LA+++gL+++qV +WF N+R ++
  XP_027337487.1 236 KWPYPTDADKVALAEWTGLDQKQVNNWFVNQRKRH 270
                     569*****************************885 PP

2ELK24.75.6e-09192211322
             ELK   3 KhqLlrKYsgyLgsLkqEFs 22 
                     K+ Ll+ Ysgy+ +Lk+EFs
  XP_027337487.1 192 KDGLLHRYSGYITNLKHEFS 211
                     888****************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    
MENLYNFHFS SSYSEQPSMA PPPSQPPPAL NAISSIRTFV QSSSSSSDDS IKALQTKVAS  60
HPLFPQLLQA HIDCHKVGAP PEMAQVFDGM RGENSGVCHI SGFSGADPDL DLFMEMYCDL  120
LVKYKWDLSR PYDEATAFLN HMETQLHSIC HPAATNNTPQ TDEVGGSSEK DFSTVEKEAT  180
VEGRRNEVQE FKDGLLHRYS GYITNLKHEF SKKKKKEKLP KQAKQILLAW WNVHFKWPYP  240
TDADKVALAE WTGLDQKQVN NWFVNQRKRH WKSTEEMQAI ILNGLYGPPH Q
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.17e-73TALE family protein