PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027335991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 297aa    MW: 33758.2 Da    PI: 6.7999
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027335991.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.49.9e-082422752154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_027335991.1 242 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 275
                     469*****************************87 PP

2ELK25.53.1e-09196217122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_027335991.1 196 ELKIELKQGFKSRIEDVREEIL 217
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    
MQEPGLGMGM GMISGEMSLS GGGDHHHHHR QVKAEIATHP LYDQLLAAHV SCLRVATPID  60
HLPLIDAQLS QSQHLLRSYA SHHSLSLSPH DRQELDNFMS QYLIVLCTFK EQLQQHVRVH  120
AVEAVMACRD IESTLQALTG VSLGEGTGAT MSDDEDEMQM DVSLDQSSAE GHDMMGFGPL  180
LPTESERSLM ERVRQELKIE LKQGFKSRIE DVREEILRKR RAGKLPGDTT SVLKAWWQQH  240
AKWPYPTEDD KAKLVEETGL QLKQINNWFI NQRKRNWHSN SQSVTSLKSK RKREYSH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273293RKRNWHSNSQSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-162TALE family protein