PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027332977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 568aa    MW: 62964.8 Da    PI: 6.5958
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027332977.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.7e-084875251854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  XP_027332977.1 487 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 525
                     5887779******************************88 PP

2BELL67.62.4e-22358426170
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
                     +r++ +  k++Ll ll+ Vd+rY+q+ ++++tv+s+F+a+++l++ ++++++Al++iS  ++ L+++i++
  XP_027332977.1 358 QRHAAEPNKSQLLMLLQLVDNRYSQCLDEIHTVVSAFHAATELDP-HMHAHFALQTISLLYKDLRERISN 426
                     57888999*************************************.**********************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    
MENDMYSAPL DMAGRNSNVI EGITQHFAPK PLIYCYSFDL NNQNPIINGI PILAGEQGEP  60
ITTSNVHDEG RIINPPGVAG SNSFVTSQGK NFVGDASNLI NNDFQEHLAG GRPITPASIA  120
ARIGLQETLG NSTTLSPSVC SLEALGPYIF NNWQDTSNPL PATFGDHGYD EVHCNGKWNV  180
NKFPKAQEVD GTGFLAHSSI GNLDPSGWTS SNIANLANLA YNSSNCSNEL SLSLARSPTT  240
GQCSEMSCSD VSHCMNGTKS GLEQPSCSSK ELSMSLGSNK HVQFSPAILG SRYLAVIQEI  300
LAQIATYSFE NVEQVNYSAA GVKAGGNKYT SVFMPKRRVA INQNVNSMSE AHVESPLQRH  360
AAEPNKSQLL MLLQLVDNRY SQCLDEIHTV VSAFHAATEL DPHMHAHFAL QTISLLYKDL  420
RERISNCILA MGSNFNSSCS EEEMEWSVET SFIQKQWALQ QLKRKDQLWR PQRGLPERSV  480
SVLRAWMFQN FLHPYPKDAE KHLLAVKSGL TRSQVSNWFI NARVRLWKPM IEEMYAEMNR  540
RKACRNEEGM ESTHRGRISM NNQMLNIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-105TALE family protein