PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027332510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 380aa    MW: 43517.4 Da    PI: 6.6787
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027332510.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093073422055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_027332510.1 307 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 342
                     5679*****************************885 PP

2ELK37.84e-13262283122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_027332510.1 262 ELKNHLLRKYSGYLSSLKQELS 283
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    
MEEYTNNNHL SENTGPSPSP RPNFLYSSGT GGGNHHNHHH HHHHHQFPIN TFHLQSGGSD  60
HCFQSDQVAP HPSVKTEAST SQLHSPIFHY PLMRGTLHNT STTMHPQQGG SPTNSSEVEA  120
IKAKIIAHPQ YSNLLDAYMD CQKIGAPPEV VARMVAAKQE FEARQRSSVG SRETSEDPEL  180
DQFMEAYYDM LVKYREELSR PIQEAMDFMR RIETQLNMLC NGPVRIFSDD KCEGVGSSEE  240
DQDNSGGETE LPEIDPRAED RELKNHLLRK YSGYLSSLKQ ELSKKKKKGK LPKDARQKLL  300
NWWELHYKWP YPSESEKVAL AESTGLDQKQ INNWFINQRK RHWKPSEDMQ FMVMDGLHPQ  360
SATLYMDGHY MADGHYRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-150TALE family protein