PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027332206.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 318aa    MW: 36369.3 Da    PI: 6.8553
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027332206.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.1e-092482822155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  XP_027332206.1 248 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 282
                     569*****************************885 PP

2ELK38.42.6e-13202223122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLk+EF+
  XP_027332206.1 202 ELKVQLLRKYSGYLGSLKKEFL 223
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    
MIGFGGNSCS ELSSMDMMNM ETNRKFLSLP LSNNSGAQMR SDNRRVSVTT SIAQDHNYTH  60
QNHTDNCSVR DKIMAHPLFP RLLSSYLNCL KVGAPPEVVA SLEESCAKCE SFNASSGRTG  120
SGSIGEDPAL DQFMEAYCEM LIKYEQELTK PFKEAMLFFS RIECQLKALA VSTTDFGQSE  180
SSSLNEVDVH ENNLDTQAED RELKVQLLRK YSGYLGSLKK EFLKKKKNGK LPKEARQQLL  240
DWWNRHYKWP YPSESQKQAL AESTGLDLKQ INNWFINQRK RHWKPSEDMQ FAVMDATNYY  300
MENVMCKPFP MDGMPMLL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-107TALE family protein