PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027331602.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 360aa    MW: 40467.5 Da    PI: 6.5541
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027331602.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092863221955
                     HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_027331602.1 286 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 322
                     45679*****************************885 PP

2ELK37.84.1e-13242263122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlr YsgyLgsLkqEF+
  XP_027331602.1 242 ELKGQLLRRYSGYLGSLKQEFM 263
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    
MEGNSSVMGF GENTTSSGVC PMMMMPLVTS HHVGHHPINP NLNNPNPNPS EDTNISFLPS  60
PCNNNHQHIN RNIMLDSNHN ANTSGLGYFM DIHNTNNDGS SSSSSSAVKA KIMAHPHYHR  120
LLAAYVNCQK VGAPPEVVAR LEEACASAAV TMAGGTACIG EDPALDQFME AYCEMLIKYE  180
QELSKPFKEA MLFLQRIEGQ FKSLTISSSS DTACNEATDR NGSSEDVDVH NNLIDPQAED  240
QELKGQLLRR YSGYLGSLKQ EFMKKRKKGK LPKEARQQLL EWWSRHYKWP YPSESQKLAL  300
AESTGLDQKQ INNWFINQRK RHWKPSEDMQ FVVVDPSHPH YYMENVLGNP FPMDLSHTML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258267LKQEFMKKRK
2264268KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-135TALE family protein