PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027329907.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 344aa    MW: 39606.2 Da    PI: 6.1544
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027329907.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.4e-072843162254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_027329907.1 284 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 316
                     69*****************************87 PP

2ELK29.22.1e-10237258122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_027329907.1 237 ELKHELKQGYKEKIVDIREEIL 258
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    
MAFHDHLHHE IAFQRFTEQQ QLTENRDMQQ RLPPTWLNNV NAAHQRQQNF LDSTEKSVDR  60
NLNESNCESE DLRGYKADIL GHPLYDQLLS AHVSCLRIAT PVDQLPRIDA QLQQSQRVVE  120
KYSALANAVV DEKELDQFMT HYLLLLCAFK EQLQQHVRVH AMEAVMACWD LEQSLQSLTG  180
VSPGEGTGAT MSDDEDDQAE SNGNLYEGSI DGTETLGFGP LVPTETERSL MERVRHELKH  240
ELKQGYKEKI VDIREEILRK RRAGKLPGDT TSLLKAWWQA HSKWPYPTEE DKARLVQETG  300
LQLKQINNWF INQRKRNWHT NPSSSTNSKS KRKSTGETSN QSFM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-157TALE family protein