PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027329543.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Abreae; Abrus
Family TALE
Protein Properties Length: 414aa    MW: 46613.9 Da    PI: 6.2307
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027329543.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.6e-083633962154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_027329543.1 363 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 396
                     469*****************************87 PP

2ELK28.82.7e-10317338122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_027329543.1 317 ELKHELKQGYKEKIVDIREEIL 338
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    
MAYHNQHLSQ QDNPLHYFPH HSLRSVLPDQ QQLPSSPDPT SKPPSDPHPL QTAPNWLNDA  60
LLRPHYTDNT TNNNDNDNNN NVNNNGSNFL NLHSTSSAQW LARPILPRNR SEVIDDVAAT  120
AGDSLIAGGE SSDLKEGKGE GDGVNLQIGR WKAEILAHPM YEQLLSAHVA CLRIATPVDQ  180
LPRIDAQLAQ SQNVVAKYSA FGHAAQNMLG DDKDLDHFMS HYVLLLCSFK EQLQQHVRVH  240
AMEAVMACWE IEQSLQSLTG VSPGEGTGAT MSEDEDDQVD SDANLFDNSL DGPDSMGFGP  300
LVPTENERSL MERVRLELKH ELKQGYKEKI VDIREEILRK RRAGKLPGDT TSVLKAWWQS  360
HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS NPSTSTVLKS KRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1394414RKRNWHSNPSTSTVLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0TALE family protein