PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc06064.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 358aa    MW: 37974.6 Da    PI: 10.6597
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc06064.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC26.61.1e-082242452445
                           WRC  24 gkklCErHlhrgrsrsrkskee 45 
                                   g+k+CErH+hrgr rsrk++e+
  Zpz_sc06064.1.g00010.1.am.mk 224 GHKYCERHVHRGRGRSRKPVEA 245
                                   9******************986 PP

2QLQ46.51.1e-1697132237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   a+T +Q q+L++Q+l+y+yLaa++ vP +L+++i+k
  Zpz_sc06064.1.g00010.1.am.mk  97 ALTFMQQQELEQQVLIYRYLAAGAAVPVHLVLPIWK 132
                                   79********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-496132IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.8E-1097131IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.3697132IPR014978Glutamine-Leucine-Glutamine, QLQ
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MPPVPVTFRA RDSRRPSSPA SPAPTLTPVR ACLQVVRAAE LGHVSRVLDR FAELYYTDTV  60
TTAAALSPLV LGLGLGLGVG RDSTGERDAE ANKARPALTF MQQQELEQQV LIYRYLAAGA  120
AVPVHLVLPI WKSVAASSFS PQRSPSRTCP FVIPFVVSAA ASSIFTNWIT CVAGCNKNVY  180
VLMSGIDGPG EPVLRLPPQH GAGTRSVPAH GRQEVAVLAR RGTGHKYCER HVHRGRGRSR  240
KPVEATSAGA PAAVAAHHHG RAGASPGAAG LGFSPTTTTS VLLAHSVLVS ELFEPDRAAR  300
WHARVALLGR STVLLLPRGW EHCLCGSYWG QRGAERLVSG FGSEPSLGGL SLPMPLPR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc06064.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9659721e-73EU965972.1 Zea mays clone 290465 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955149.13e-36growth-regulating factor 10
TrEMBLK3YVF68e-35K3YVF6_SETIT; Uncharacterized protein
STRINGSi018252m1e-35(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.16e-14growth-regulating factor 3