PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc05527.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 196aa    MW: 20176.4 Da    PI: 9.2554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc05527.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof59.66.3e-191333062
                        zf-Dof 30 ryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  r+fCkaCrryWt+GGalrnvPvGgg+r+n k+ 
  Zpz_sc05527.1.g00010.1.am.mk  1 RHFCKACRRYWTRGGALRNVPVGGGCRRNTKRA 33
                                  9***************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088417.28131IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-11131IPR003851Zinc finger, Dof-type
PfamPF027015.3E-13131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
RHFCKACRRY WTRGGALRNV PVGGGCRRNT KRASKKASRQ GAAGGATAAS SSSSTTATST  60
TVTTTTTSSA AAAEVLASMH AQLPHLGLPP AVALEASLEG HHHYLPLQMQ QQFLQQGLDG  120
YHFTDGDGGG VFADGLPRGV ASGLLAQLAA VKMEGHNNGG AVAAAHEQSY WPGSGGNEWP  180
TEFLSGFSLS SSGNVL
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc05527.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001333768.18e-62uncharacterized protein LOC103650524
TrEMBLA0A0A9DMN53e-69A0A0A9DMN5_ARUDO; Uncharacterized protein
STRINGPavir.Ca02598.1.p6e-63(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.18e-16Dof family protein