PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04896.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 516aa    MW: 56264.6 Da    PI: 8.2914
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04896.1.g00010.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS250.56.3e-771095094374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgd.pmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                    +l+c+ +++ g++ +a+a+L+ ls  +s +gd ++qR++  f+eAL +r ++  ++l+ +l+ +   +  +   +++ + 
  Zpz_sc04896.1.g00010.1.sm.mk 109 IILQCVACLDMGNAVAASAALQYLSSVVSFAGDvALQRVVLAFAEALGRRAMQLLPGLAWSLQLKVLLPPPTPAYINSAQW 189
                                   689*****************************559************************9998776665555555555555 PP

                          GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                    f  ++P+++++  +aN+aI ea++ e+rvH++D++  ++ QW+aL++ +a+R++gpp lR+T v++    ++  l++ + 
  Zpz_sc04896.1.g00010.1.sm.mk 190 sFAMLFPLIRVAATAANNAIKEATAAERRVHVVDLGGANPNQWLALIRLFAARSRGPPFLRLTIVNE----DQSFLSQAAG 266
                                   5******************************************************************....99******** PP

                          GRAS 164 rLakfAeelgvpfefnvl..vakrledleleeLrvkp..gEalaVnlvlqlhrll.........................d 215
                                    L++ A +l+vpf fn++  + +r++  ++ +L v +  +Eal++ + lq hrl                           
  Zpz_sc04896.1.g00010.1.sm.mk 267 VLTQAAVRLHVPFVFNPVqdHIDRFTPASVAALGVAQgrDEALVITSTLQFHRLIadkvtedlpaesrnkkrknvdtttaT 347
                                   *****************8666677777799999999999************************************988644 PP

                          GRAS 216 esvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                                    s++++ + d++L+++ +l Pk++v++eq+a+hn++ + +r+ +a++yy +lf  lea  + +  +r +vE++ll++e +n
  Zpz_sc04896.1.g00010.1.sm.mk 348 TSHEIT-KADALLRVLCDLTPKLMVLTEQDANHNDQVLSNRVRNAIDYYEVLFRDLEAA-GGDPMTREFVEHMLLKEEMKN 426
                                   444444.59***********************************************999.7888***************** PP

                          GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.....eesgslvlgWkdrpLvsvSa 372
                                   +++cega rrerhe+le W  r++ aGF+ +++s++a k++ +l ++ ++dg ++       ++g+l+l+ ++ ++++vSa
  Zpz_sc04896.1.g00010.1.sm.mk 427 IISCEGALRRERHEKLEYWFPRMKVAGFELAAVSDDAFKDVASLAHQLSGDGIKWTlgahkIDKGCLLLYSRKISIFAVSA 507
                                   ****************************************************999877665669***************** PP

                          GRAS 373 Wr 374
                                   W+
  Zpz_sc04896.1.g00010.1.sm.mk 508 WQ 509
                                   *6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.66380484IPR005202Transcription factor GRAS
PfamPF035142.2E-74109509IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
RPSIDVNFTN CLFKPYVAMS SNQSRGNGKA VVAKEEDAEQ EIWLVRKKVH HQGGGPSCPG  60
EESSSLSAPA QPAANQGAKA PVEAVPVPDA NVPGPQPHGG NLSIFFYNII LQCVACLDMG  120
NAVAASAALQ YLSSVVSFAG DVALQRVVLA FAEALGRRAM QLLPGLAWSL QLKVLLPPPT  180
PAYINSAQWS FAMLFPLIRV AATAANNAIK EATAAERRVH VVDLGGANPN QWLALIRLFA  240
ARSRGPPFLR LTIVNEDQSF LSQAAGVLTQ AAVRLHVPFV FNPVQDHIDR FTPASVAALG  300
VAQGRDEALV ITSTLQFHRL IADKVTEDLP AESRNKKRKN VDTTTATTSH EITKADALLR  360
VLCDLTPKLM VLTEQDANHN DQVLSNRVRN AIDYYEVLFR DLEAAGGDPM TREFVEHMLL  420
KEEMKNIISC EGALRRERHE KLEYWFPRMK VAGFELAAVS DDAFKDVASL AHQLSGDGIK  480
WTLGAHKIDK GCLLLYSRKI SIFAVSAWQP AKKTSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-1512550922375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.11e-115hypothetical protein SORBIDRAFT_09g018540
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.16e-58scarecrow-like 3