PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04438.1.g00020.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 416aa    MW: 44236.3 Da    PI: 8.3252
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04438.1.g00020.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-3999158261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   ++k l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  Zpz_sc04438.1.g00020.1.sm.mk  99 PDKVLPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 158
                                   78999****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3188156IPR003851Zinc finger, Dof-type
PfamPF027016.4E-32100157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.984103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MGEVCRGGGG DGLIKLFGTT IPVPEAGDAK DLQLSGGSSS GSIESDATKE NNTRQQQDTS  60
DPSPQPEVVD AEDPKSSPRQ QPGADRDEAN DRKEKLRKPD KVLPCPRCNS MDTKFCYFNN  120
YNVNQPRHFC KNCQRYWTAG GAMRNVPVGA GRRKNKNALA ASYSFLQRVR AAAMPAGGGP  180
LNTNGTVLSF GGGNHQSVGP CSEGSSNRDD RNMSGTKDHV AVSNPANGVQ HPANMNGAPM  240
WPPYSCAPIP SHRPAYYPPP GIAIPIQPVA PGYWGCMVLG GWNLPWAPVP SPTSQGLSSP  300
TSAPSVSSGA DSLTVLGKHA RPEGDEGRSH GSGKVWAPKT IRIDDADEVA KSSIWSLIGI  360
KGDKKNADMD GRKQHGTVFE PKHDAKTAEQ EMITSSPHLH ANPVALTRLL TFQEGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc04438.1.g00020.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567843e-87EU956784.1 Zea mays clone 1573856 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983151.11e-171cyclic dof factor 1
TrEMBLK4AA811e-170K4AA81_SETIT; Uncharacterized protein
STRINGSi035787m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-56cycling DOF factor 2