PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04211.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 292aa    MW: 30644.3 Da    PI: 8.1751
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04211.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.91.8e-3168121357
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                                   ++rY+eClkNhA+ +GghavDGCgEfm++ ge g+++al+CaACgCHRnFHR+e+
  Zpz_sc04211.1.g00010.1.am.mk  68 TTRYRECLKNHAVGIGGHAVDGCGEFMAA-GEAGSINALRCAACGCHRNFHRKES 121
                                   579*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.1E-2869121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.4E-2970120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-2370123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.34871120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.31E-21217288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-33218288IPR009057Homeodomain-like
TIGRFAMsTIGR015654.4E-27227283IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDFDEHDDGD EEMPPMPVSS SYDAPMQPGI VQGGSGSTPK PADSGGGGSF STPGGGSGGV  60
GGRAGGGTTR YRECLKNHAV GIGGHAVDGC GEFMAAGEAG SINALRCAAC GCHRNFHRKE  120
SGSPTGAEPV ALSPAAITPY GVAAPHQFSP YYRTPAGYLY HQQQHQQHLA AAAAAGHMHR  180
PLALPSTSHS GGRDEGDDIS RMIGPMVVAP MVGMSLSSGG GASGSGKKRF RTKFTQEQKD  240
RMLAFAERLG WRIQKHDEAA VQQFCEEVGV KRQVLKVWMH NNKHTLGRKP LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-302282851875ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16066GGRAGGG
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc04211.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149424.21e-141uncharacterized protein LOC100283050
SwissprotA2YWA61e-120ZHD2_ORYSI; Zinc-finger homeodomain protein 2
SwissprotQ6ZB901e-120ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
TrEMBLA0A1D6KLI51e-139A0A1D6KLI5_MAIZE; ZF-HD protein dimerization region containing protein
TrEMBLA0A317YC701e-139A0A317YC70_MAIZE; Zinc-finger homeodomain protein 2
STRINGGRMZM2G346920_P011e-140(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.12e-54homeobox protein 21
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]