PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04139.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 663aa    MW: 73085.7 Da    PI: 6.7854
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04139.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.57.5e-1122906611373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zpz_sc04139.1.g00010.1.am.mk 290 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 367
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N +I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++RiTg++ p++g   +e++ee
  Zpz_sc04139.1.g00010.1.am.mk 368 QLYMAAICFKKMAFIFSNYTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISCREGGPPEVRITGIDLPQPGfrPTERIEE 448
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL ++A+e+gvpf++++++a+++e+++ e+L ++p+E+l+Vn+++q  +l+desv +es+rd vL+ +++++P+ +++
  Zpz_sc04139.1.g00010.1.am.mk 449 TGRRLGNYAREFGVPFKYHAIAASKMESIRKEDLTIDPDEVLIVNCMYQFRNLMDESVVIESPRDVVLNNIRKMQPHAFIH 529
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr + nv+aceg++r+er et+++W+ r ++a
  Zpz_sc04139.1.g00010.1.am.mk 530 AIVNGSFSAPFFVTRFREALFYYSALFDILDTTTPRNSDQRMLIEQNIFGRTALNVIACEGTDRVERPETYKQWQVRNQRA 610
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   G+k++pl++++++ +++ ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zpz_sc04139.1.g00010.1.am.mk 611 GLKQLPLNQEIVQVVRSKVKDCYHKDFVIDVDHNWLLQGWKGRILYAISTW 661
                                   ***********************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.143264642IPR005202Transcription factor GRAS
PfamPF035142.6E-109290661IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
TRVFPPSSNL PLPCLQSLLP SRLPASRSRP GDLNSSFPLP PPSPHAAAAM GSSFYDPSPA  60
GAADPSLYFY LPDLVPDSPS SYLDLPPTTH HQQPPVSSDG GGGNGATGSP EDLVLPYISR  120
MLMEDDIEDK FFYDYPDNPA LLQAQQPFLD ILSNSDDSSA TTGDKVAARS DGPFAPAPPP  180
PSAASVKEEG LVNAAPGAGV SRGRKNPYDD DELEAESGRS SKQSAVQGGG GDDATRDMLD  240
RVMMPSPESC LQQMQQLRIA MQEEAAKNEA GGKAGNGKAN GRGGRKVVDL RTLLIHCAQA  300
VATDDRRSAT ELLKQIKQHA SPQGDGTQRL AHCFAEGLQA RLAGTGSMVY QSLMAKRTSA  360
VALLQAYQLY MAAICFKKMA FIFSNYTIYN ASLGKKKIHI VDYGIQYGFQ WPCFLRRISC  420
REGGPPEVRI TGIDLPQPGF RPTERIEETG RRLGNYAREF GVPFKYHAIA ASKMESIRKE  480
DLTIDPDEVL IVNCMYQFRN LMDESVVIES PRDVVLNNIR KMQPHAFIHA IVNGSFSAPF  540
FVTRFREALF YYSALFDILD TTTPRNSDQR MLIEQNIFGR TALNVIACEG TDRVERPETY  600
KQWQVRNQRA GLKQLPLNQE IVQVVRSKVK DCYHKDFVID VDHNWLLQGW KGRILYAIST  660
WGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-442946618374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
SwissprotO809331e-167SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-155GRAS family protein