PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04034.1.g00030.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 312aa    MW: 33298.2 Da    PI: 8.9765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04034.1.g00030.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.6e-39102162262
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                     ++k+l+cprC+s +tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  Zpz_sc04034.1.g00030.1.sm.mkhc 102 PDKILPCPRCNSVDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSAS 162
                                     7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.4E-32104160IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-22105151IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAKCRAQGGG GGGDCLIKLF GKTIPVPEAA AAAAAGDADK DLQQSGSSTT EPKGQETTLQ  60
DSTGSPPQQG VTDTKESSAE KNSSSDQQQG ETTNKKEKLK KPDKILPCPR CNSVDTKFCY  120
YNNYNINQPR HFCKNCQRYW TAGGAMRNVP VGAGRRKSKS ASAASQFLQR VRAALPIDPL  180
CTSARTNGTV LSFGSDMSSL ELAEQMKHLK EKLVPISRIK NSDDQSAGIP IPFYPAAAGY  240
WGCMVPGAWN TSWLPHSQSE TTTSPSAASP ASAKSNCFTS GKRPRDGDEE GNTTGNGKVW  300
VPKTIRIDDA DK
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc04034.1.g00030.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2604560.0GQ260456.2 Eleusine coracana Dof-type zinc finger protein (DOF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985552.11e-176cyclic dof factor 1
TrEMBLK4AAA51e-175K4AAA5_SETIT; Uncharacterized protein
STRINGSi035812m1e-176(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-36cycling DOF factor 2