PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04016.1.g00030.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 215aa    MW: 23596.5 Da    PI: 6.0192
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04016.1.g00030.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.71.2e-1465117155
                                     CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                             HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                                     r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  Zpz_sc04016.1.g00030.1.sm.mkhc  65 RKLSHNAYERDRRKQLNELYSSLRSLLPDA--DHTKKLSIPTTVSRVLKYIPELQ 117
                                     6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474598.9E-1762132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.01E-1164120No hitNo description
PROSITE profilePS5088814.31664116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.0E-1365132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.9E-1265117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.9E-1070122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MDHRLFNDPF ASSISSLEPD IFSGGQLPWP DLDLDDDDIN DLSPPAANAA TSSGDYGSGG  60
SGTNRKLSHN AYERDRRKQL NELYSSLRSL LPDADHTKKL SIPTTVSRVL KYIPELQKQV  120
DSLEKKKKEL TNANCKPGLS KASESIAPVV SATCLNDMEI MLQVSLPTNL AATTIPLSKC  180
IKLLENEGVQ LISSSTHSTF ENRTFYSLHL QKFSA
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc04016.1.g00030.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971295.11e-107transcription factor ORG3
SwissprotA2WZ606e-88IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2
TrEMBLK3XLE71e-105K3XLE7_SETIT; Uncharacterized protein
STRINGSi002720m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.11e-32bHLH family protein