PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03830.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 268aa    MW: 28026.3 Da    PI: 10.4809
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03830.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof100.11.4e-31105158558
                          zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                                      ++cprC s+ntkfCyynnys sqPry+C+aCrr+Wt+GG+lr+vPvGggr+++
  Zpz_sc03830.1.g00040.1.sm.mkhc 105 PRQCPRCGSANTKFCYYNNYSRSQPRYLCRACRRHWTEGGTLRDVPVGGGRKNR 158
                                     679**********************************************97654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.0E-29106158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.021106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-16113151IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MHRASPWHSR CSKRAPFDDA LSAVSNKLPW PSPRRRDRHA VVLLSGRLSF LFRFGQGHGV  60
NSDVGGVPTS GVGDIVVSAA SSVAPPSTGS RHAGARHPPQ PRPPPRQCPR CGSANTKFCY  120
YNNYSRSQPR YLCRACRRHW TEGGTLRDVP VGGGRKNRRG GGGGAAAKAS SSSAPVLPLG  180
AGNGSADVAF PDVLRQVLFQ PVGSVSGAGY SIDLSSWQQM TAATAPPQGT GGDANGALGL  240
GGTSTMDAHC GALQYWSGWQ QDDVPGLD
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03830.1.g00040.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9672437e-75EU967243.1 Zea mays clone 300623 hypothetical protein mRNA, complete cds.
GenBankKJ7279857e-75KJ727985.1 Zea mays clone pUT6101 C2C2-DOF transcription factor (DOF13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001144294.11e-46uncharacterized protein LOC100277177
TrEMBLA0A0E0BC732e-48A0A0E0BC73_9ORYZ; Uncharacterized protein
STRINGOGLUM10G14340.13e-49(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.17e-18Dof family protein