PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03791.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 368aa    MW: 38102.7 Da    PI: 9.4006
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03791.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.4e-3788146361
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Zpz_sc03791.1.g00050.1.am.mk  88 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 146
                                   56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3971145IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.78991145IPR003851Zinc finger, Dof-type
PfamPF027017.8E-3291145IPR003851Zinc finger, Dof-type
PROSITE patternPS01361093129IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MIFPPAFLDS SSWNDNQHHQ QQQQAHHQVA ANNGDGTNHE QLLHPSIMSG GALPEGGGGA  60
GAGAQMVGPA KPMSMSERAR LARIPLPEPG LKCPRCDSTN TKFCYFNNYS LSQPRHFCRA  120
CRRYWTRGGA LRNVPVGGGY RRHAKRAKPK AAAAATPGGT TAAATAALVP SGSTSSTCTT  180
ANAPALSGPA GMLGGNLSML PPLLRLADFD AMSLGSSFTG IGKPTLDAAG NYSIGGASGG  240
GAGAGLEQWR VHQQMQGFPF LHAMDQGSLP PSLAMVMPGA FQLGLDTTDG RGVGTGGGED  300
GSTGDLNGMP TKREGGYPRG MYGDHHLAAG YTTSYSNATG LGRTRPDPWP AGRPLAHRFP  360
SPVLPFGE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03791.1.g00050.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0793564e-98AC079356.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0016H04, complete sequence.
GenBankAK1089334e-98AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
GenBankAP0149614e-98AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankGQ1835524e-98GQ183552.1 Oryza sativa Japonica Group Dof-type zinc finger protein 25 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025807608.11e-119dof zinc finger protein DOF3.6-like isoform X1
TrEMBLA0A0A9DJ881e-129A0A0A9DJ88_ARUDO; Uncharacterized protein
STRINGPavir.Ca00639.1.p1e-118(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-45OBF-binding protein 3