PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03673.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 850aa    MW: 89478.4 Da    PI: 10.221
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03673.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.81e-37556617263
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                   kekal+cprC stntkfCyynnys +qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Zpz_sc03673.1.g00020.1.am.mk 556 KEKALNCPRCSSTNTKFCYYNNYSRHQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 617
                                   7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-29552614IPR003851Zinc finger, Dof-type
PfamPF027014.4E-32558614IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.621560614IPR003851Zinc finger, Dof-type
PROSITE patternPS013610562598IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MRPDARRTSI PSLAWFNVIL VSRHSNVPSH SEDALALETH TRDATRSEAV SSRTKVTVGD  60
AAGLGVEIWS LLSSASYRSL GGVGLLMTVL TQLSTSSRHP ARPKQRRPPN PTFLPLSSSQ  120
RRNVQRGSFR CHRSFCRTFA FEPMTFPATG VQRSLTGCSF STTGLSLTNE QNGPPLLKPD  180
GRTTTKQPPP FHSRGSLVPC LIRFQKPGNI PLLVIAFASD ASSQAVEDKA KSDRRSSGRG  240
DRKASRLGEF SVRITAGSDV DRDYSGMPDS GQLPEKSMVH GDIPLPVADA VYIIAQEMRS  300
CYALADGRTP WNCAGSDKEM EGPLSLGTFL AFRSRVTFEI FLTPLHPVLF WVAFPIDGGL  360
ATAGYERGHA MIRSPVGGAI MAAYSSVRRA ERRSDWRAQG DGRWVPGGRN ARCLWRGSAA  420
CARAECDRFG RGAGERGAAR VVASLAPPVT AHRLVPGART LNRRRGYARL PSTPVLVQSE  480
GSGEEQGGEG LGLVKPMEDM LMAANAPAGN PSQGSNPNPS ATAPAPSLTP GGALRGGAPA  540
AVPGAGSAER RVRPQKEKAL NCPRCSSTNT KFCYYNNYSR HQPRYFCKTC RRYWTEGGSL  600
RNVPVGGGSR KNKRSSSSSA STSASASVTS SSMASSMGVA SKNPKLTHEG AQDLNLAFPS  660
GLPAPGDFAA FPSLESGNMC NPGGAMTSNG RGVGTGSAVG ALSAMELLRS TGGYMPLQVP  720
MQMPRDYAAA GFSFGEFRAP PPPSQSVLGF SLDAHGSAAG TAAAGYGSGA RLQGAPENAS  780
RLLFPFEDLK TPVTSGDGDG DAGASGDTGD GNNGRHQFEH GKEQTAGGPS AGHDTPGFWN  840
GMIGGSGTSW
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03673.1.g00020.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-42Dof family protein