PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03623.1.g00060.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 347aa    MW: 37586.9 Da    PI: 9.1056
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03623.1.g00060.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.81e-2492136145
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   d+epgrCrRtDGKkWRCsr++++++k+CE+H+hrg++rsrk++e+
  Zpz_sc03623.1.g00060.1.sm.mk  92 DPEPGRCRRTDGKKWRCSREAYGDSKYCEKHIHRGKNRSRKPVEA 136
                                   79****************************************986 PP

2QLQ58.71.8e-201852236
                           QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                                   FTa+Q+q+L++Q+l+yKy+a ++PvP++L+++++
  Zpz_sc03623.1.g00060.1.sm.mk 18 LFTASQWQELEHQALIYKYMATGAPVPHDLVVPLR 52
                                  5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-91753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.2951853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.5E-151951IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.45892136IPR014977WRC domain
PfamPF088794.6E-2093135IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MLSGHTGGAA AGRGGRRLFT ASQWQELEHQ ALIYKYMATG APVPHDLVVP LRLATGVDTV  60
PSLAFPPQPP SLGYWGCYGA AAAQFGRKAA EDPEPGRCRR TDGKKWRCSR EAYGDSKYCE  120
KHIHRGKNRS RKPVEATTSP ATTVNNAAAY RPSALSISPP APDAPAPPPS YGHVHHYHHP  180
LHHHGANSAS PLQLHLDAAG YQYHAPSPPP SYHRYAHAQT SLFPGGYGGP SARELQEAEL  240
RRQRCLALGA DLSLDKPAAT ATEKPLRRFF DEWNGGGDDA TQLSISMPTA SPSASRYHNG  300
ESACKKKGSD RCHSFSQLPV QHEEKSIHSS HQLHELGTVS IKFAEAL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03623.1.g00060.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0349191e-126BT034919.1 Zea mays full-length cDNA clone ZM_BFb0028B17 mRNA, complete cds.
GenBankBT0358751e-126BT035875.1 Zea mays full-length cDNA clone ZM_BFb0086L11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964939.11e-121growth-regulating factor 2
SwissprotQ6AWY74e-96GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A1E5WIJ31e-124A0A1E5WIJ3_9POAL; Growth-regulating factor 2
STRINGSi006922m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-39growth-regulating factor 5